HPA012410

OTOF antibody from Sigma-Aldrich
DFNB6, DFNB9, FER1L2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012410
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012410, RRID:AB_1854836
Product name
Anti-OTOF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012410
Antibody type
Polyclonal
Antigen
Otoferlin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAY
CPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGP
AGKADLPPINGPVDVDRGPIMPVPMGIRPVLSKYR
VEVLFWGLRDLKRVNL
Storage
-20C
Provider Type Product Number
- No reagents -