HPA012410

OTOF antibody from Atlas Antibodies
DFNB6, DFNB9, FER1L2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012410
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012410, RRID:AB_1854836
Product name
Anti-OTOF
Provider product page
Atlas Antibodies - HPA012410
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAY
CPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGP
AGKADLPPINGPVDVDRGPIMPVPMGIRPVLSKYR
VEVLFWGLRDLKRVNL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -