Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406285 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TNFAIP8L1 antibody: synthetic peptide directed towards the middle region of human TNFAIP8L1
- Reactivity
- Human, Mouse, Bovine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLR
RICEG LGRMLDEGSL- Vial size
- 50 µg
Submitted references Towards a proteome-scale map of the human protein-protein interaction network.
Rual JF, Venkatesan K, Hao T, Hirozane-Kishikawa T, Dricot A, Li N, Berriz GF, Gibbons FD, Dreze M, Ayivi-Guedehoussou N, Klitgord N, Simon C, Boxem M, Milstein S, Rosenberg J, Goldberg DS, Zhang LV, Wong SL, Franklin G, Li S, Albala JS, Lim J, Fraughton C, Llamosas E, Cevik S, Bex C, Lamesch P, Sikorski RS, Vandenhaute J, Zoghbi HY, Smolyar A, Bosak S, Sequerra R, Doucette-Stamm L, Cusick ME, Hill DE, Roth FP, Vidal M
Nature 2005 Oct 20;437(7062):1173-8
Nature 2005 Oct 20;437(7062):1173-8
No comments: Submit comment
No validations: Submit validation data