HPA035652

C9orf66 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035652
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035652, RRID:AB_10601151
Product name
Anti-C9orf66 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035652
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf66 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPR
RLRTSRSTEILGEDLAGPSAGAAARPAAPPPQPRE
PGA
Storage
-20C
Provider Type Product Number
- No reagents -