HPA052851

ERP27 antibody from Atlas Antibodies
C12orf46, ERp27, FLJ32115, PDIA8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA052851
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052851, RRID:AB_2681972
Product name
Anti-ERP27
Provider product page
Atlas Antibodies - HPA052851
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FQDLEIPAVPILHSMVQKFPGVSFGISTDSEVLTH
YNITGNTICLFRLVDNEQLNLEDEDIESIDATKLS
RFIEINSLHMVTEYNPVTVIGLFNSVIQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -