H00121506-B01P

ERP27 antibody from Abnova Corporation
C12orf46, ERp27, FLJ32115, PDIA8

Antibody data

Product number
H00121506-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00121506-B01P, RRID:AB_1571814
Product name
C12orf46 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00121506-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C12orf46 protein.
Antigen sequence
MEAAPSRFMFLLFLLTCELAAEVAAEVEKSSDGPG
AAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIP
AVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNT
ICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINS
LHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEY
EENMHRYQKAAKLFQGKILFILVDSGMKENGKVIS
FFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHV
QNFCDGFLSGKLLKENRESEGKTPKVEL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -