SAB1400786

ERP27 antibody from Sigma-Aldrich
C12orf46, ERp27, FLJ32115, PDIA8
ELISA
Recommended by provider

Antibody data

Product number
SAB1400786
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400786, RRID:AB_1845539
Product name
Anti-C12orf46 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400786
Antibody type
Polyclonal
Antigen
C12orf46 (NP_689534, a.a. 1-273) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MEAAPSRFMFLLFLLTCELAAEVAAEVEKSSDGPG
AAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIP
AVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNT
ICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINS
LHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEY
EENMHRYQKAAKLFQGKILFILVDSGMKENGKVIS
FFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHV
QNFCDGFLSGKLLKENRESEGKTPKVEL (witho
ut GST)
Storage
-20C
Provider Type Product Number
- No reagents -