HPA073875

DHX33 antibody from Atlas Antibodies
DDX33, DKFZp762F2011, FLJ21972

Antibody data

Product number
HPA073875
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA073875, RRID:AB_2686638
Product name
Anti-DHX33
Provider product page
Atlas Antibodies - HPA073875
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQ
LDLLGALEHKDDQLTLTPMGRKMAAFPLEPKFAKT
ILMS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -