Antibody data

Product number
PAB19973
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB19973, RRID:AB_10961845
Product name
KLHDC7B polyclonal antibody
Provider product page
Abnova Corporation - PAB19973
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant KLHDC7B.
Antigen sequence
GLCTMHNYLFLAGGIRGSGAKAVCSNEVFCYNPLT
NIWSQVRPMQQARAQLKLVALDGLLYAIGGECLYS
MECYDPRTDAWTPRAPLPAGTFPVAHEAVACRGDI
YVTGGHLFYRLLRYSPVKDAWDECPYSASHRRSSD
IV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -