HPA000518

KLHDC7B antibody from Sigma-Aldrich
MGC16635
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000518
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000518, RRID:AB_1079213
Product name
Anti-KLHDC7B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000518
Antibody type
Polyclonal
Antigen
Kelch domain-containing protein 7B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLCTMHNYLFLAGGIRGSGAKAVCSNEVFCYNPLT
NIWSQVRPMQQARAQLKLVALDGLLYAIGGECLYS
MECYDPRTDAWTPRAPLPAGTFPVAHEAVACRGDI
YVTGGHLFYRLLRYSPVKDAWDECPYSASHRRSSD
IV
Storage
-20C
Provider Type Product Number
- No reagents -