HPA008012

GPD2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008012
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008012, RRID:AB_1079013
Product name
Anti-GPD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008012
Antibody type
Polyclonal
Antigen
Glycerol-3-phosphate dehydrogenase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRKQMNLAYVKAADCISEPVNREPPSREAQLLTLQ
NTSEFDILVIGGGATGSG
Storage
-20C
Provider Type Product Number
- No reagents -