PAB27488

STARD9 antibody from Abnova Corporation
KIAA1300, KIF16A

Antibody data

Product number
PAB27488
Provider
Abnova Corporation
Product name
STARD9 polyclonal antibody
Provider product page
Abnova Corporation - PAB27488
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant STARD9.
Antigen sequence
GMYSEPLRQFRDSSVGDQNAQVCQTNPEPPATTQG
PHTLDLSEGSAESKLVVEPQHECLENTTRCFLEKP
QFSTELRDHNRLDSQAKFVARLKHTCSPQEDSPWQ
EEEQHRDQASGGGE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -