HPA014562

STARD9 antibody from Atlas Antibodies
KIAA1300, KIF16A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014562
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014562, RRID:AB_10603033
Product name
Anti-STARD9
Provider product page
Atlas Antibodies - HPA014562
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GMYSEPLRQFRDSSVGDQNAQVCQTNPEPPATTQG
PHTLDLSEGSAESKLVVEPQHECLENTTRCFLEKP
QFSTELRDHNRLDSQAKFVARLKHTCSPQEDSPWQ
EEEQHRDQASGGGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -