HPA014562

STARD9 antibody from Sigma-Aldrich
KIAA1300, KIF16A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014562
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014562, RRID:AB_10603033
Product name
Anti-STARD9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014562
Antibody type
Polyclonal
Antigen
StAR-related lipid transfer (START) domain containing 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GMYSEPLRQFRDSSVGDQNAQVCQTNPEPPATTQG
PHTLDLSEGSAESKLVVEPQHECLENTTRCFLEKP
QFSTELRDHNRLDSQAKFVARLKHTCSPQEDSPWQ
EEEQHRDQASGGGE
Storage
-20C
Provider Type Product Number
- No reagents -