Antibody data

Product number
H00022982-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022982-B01, RRID:AB_1204271
Product name
DIP2C MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00022982-B01
Antibody type
Polyclonal
Antigen
DIP2C (NP_055789.1, 1 a.a. ~ 1556 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MADRSLEGMALPLEVRARLAELELELSEGDITQKG
YEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSS
ASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKE
RKMAVPMPSKRRSLVVQTSMDAYTPPDTSSGSEDE
GSVQGDSQGTPTSSQGSINMEHWISQAIHGSTTST
TSSSSTQSGGSGAAHRLADVMAQTHIENHSAPPDV
TTYTSEHSIQVERPQGSTGSRTAPKYGNAELMETG
DGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDD
FEELLEVQQPDPNQPKPEGAQMLAMRGEQLGVVTN
WPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYIL
TYGKLWTRSMKVAYSILHKLGTKQEPMVRPGDRVA
LVFPNNDPAAFMAAFYGCLLAEVVPVPIEVPLTRK
DAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTG
EIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDA
NNDTAYIEYKTCKDGSVLGVTVTRTALLTHCQALT
QACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMM
HVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRD
MHWALVAHRDQRDINLSSLRMLIVADGANPWSISS
CDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRP
TDDSNQPPGRGVLSMHGLTYGVIRVDSEEKLSVLT
VQDVGLVMPGAIMCSVKPDGVPQLCRTDEIGELCV
CAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEY
PFIRTGLLGFVGPGGLVFVVGKMDGLMVVSGRRHN
ADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERI
VIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVY
CLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPC
NVLMCPHTCVTNLPKPRQKQPEIGPASVMVGNLVS
GKRIAQASGRDLGQIEDNDQARKFLFLSEVLQWRA
QTTPDHILYTLLNCRGAIANSLTCVQLHKRAEKIA
VMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYA
GCVPITVRPPHPQNIATTLPTVKMIVEVSRSACLM
TTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKK
RPAQICKPCNPDTLAYLDFSVSTTGMLAGVKMSHA
ATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVL
WCLCSVYSGHQSILIPPSELETNPALWLLAVSQYK
VRDTFCSYSVMELCTKGLGSQTESLKARGLDLSRV
RTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVST
SFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRV
RLVERGSPHSLPLMESGKILPGVRIIIANPETKGP
LGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFN
SRLSFGDTQTIWARTGYLGFLRRTELTDANGERHD
ALYVVGALDEAMELRGMRYHPIDIETSVIRAHKSV
TECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNV
VLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRD
GFLADQLDPIYVAYNM
Vial size
50 uL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -