H00085004-M03

RERG antibody from Abnova Corporation
MGC15754

Antibody data

Product number
H00085004-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00085004-M03, RRID:AB_1137007
Product name
RERG monoclonal antibody (M03), clone 1C5
Provider product page
Abnova Corporation - H00085004-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RERG.
Antigen sequence
MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEY
DPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQR
EGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEI
KKPKNVTLILVGNKADLDHSRQVSTEEGEKLATEL
ACAFYECSACTGEGNITEIFYELCREVRRRRMVQG
KTRRRSSTTHVKQAINKMLTKISS
Isotype
IgG
Antibody clone number
1C5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -