HPA013409

LRRC70 antibody from Sigma-Aldrich
LOC100130733, SLRN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013409
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013409, RRID:AB_10601911
Product name
Anti-LRRC70 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013409
Antibody type
Polyclonal
Antigen
leucine rich repeat containing 70 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLSSLIHLQANSNPWECNCKLLGLRDWLASSAITL
NIYCQNPPSMRGRALRYINITNCVTSSINVSRAWA
VVKSPHIHHKTTALMMAWHKVTTNGSPLENTETEN
ITFWERIPTSPAGRFFQENAFGNPLETTAVLPVQI
QL
Storage
-20C
Provider Type Product Number
- No reagents -