HPA011969

MOGS antibody from Sigma-Aldrich
CWH41, DER7, GCS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011969
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011969, RRID:AB_1849579
Product name
Anti-GCS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011969
Antibody type
Polyclonal
Antigen
Mannosyl-oligosaccharide glucosidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LESHAEGFRERFEKTFQLKEKGLSSGEQVLGQAAL
SGLLGGIGYFYGQGLVLPDIGVEGSEQKVDPALFP
PVPLFTAVPSRSFFPRGFLWDEGFHQLVVQRWDPS
LTREALGHWLGLLNADGWIG
Storage
-20C
Provider Type Product Number
- No reagents -