Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000395-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000395-M01, RRID:AB_489767
- Product name
- ARHGAP6 monoclonal antibody (M01), clone 6B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARHGAP6.
- Antigen sequence
RHADDNISKDGQEVTGNKMTSLNLATIFGPNLLHK
QKSSDKEFSVQSSARAEESTAIIAVVQKMIENYEA
LFMVPPDLQNEVLISLLETDPDVVDYLLRRKASQS
S- Isotype
- IgG
- Antibody clone number
- 6B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Genetic screening in C. elegans identifies rho-GTPase activating protein 6 as novel HERG regulator.
Potet F, Petersen CI, Boutaud O, Shuai W, Stepanovic SZ, Balser JR, Kupershmidt S
Journal of molecular and cellular cardiology 2009 Feb;46(2):257-67
Journal of molecular and cellular cardiology 2009 Feb;46(2):257-67
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ARHGAP6 monoclonal antibody (M01), clone 6B3 Western Blot analysis of ARHGAP6 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ARHGAP6 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol