Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310892 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the N terminal of human A4GNT
- Description
- Affinity Purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLS
HRRGI VFLETSERME- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Efficacy of S-1 for patients with peritoneal metastasis of gastric cancer.
Clinical utility of quantitative RT-PCR targeted to alpha1,4-N-acetylglucosaminyltransferase mRNA for detection of pancreatic cancer.
Ishizone S, Maruta F, Saito H, Koide N, Sugiyama A, Nakayama J, Miyagawa S
Chemotherapy 2006;52(6):301-7
Chemotherapy 2006;52(6):301-7
Clinical utility of quantitative RT-PCR targeted to alpha1,4-N-acetylglucosaminyltransferase mRNA for detection of pancreatic cancer.
Ishizone S, Yamauchi K, Kawa S, Suzuki T, Shimizu F, Harada O, Sugiyama A, Miyagawa S, Fukuda M, Nakayama J
Cancer science 2006 Feb;97(2):119-26
Cancer science 2006 Feb;97(2):119-26
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting