HPA008017

A4GNT antibody from Sigma-Aldrich
alpha4GnT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008017
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008017, RRID:AB_1078073
Product name
Anti-A4GNT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008017
Antibody type
Polyclonal
Antigen
alpha-1,4-N-Acetylglucosaminyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEV
SDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEP
SFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRK
HCPRTYRDLIKGPEGSVTGELG
Storage
-20C
Provider Type Product Number
- No reagents -