HPA008482

CA14 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008482
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008482, RRID:AB_1078395
Product name
Anti-CA14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008482
Antibody type
Polyclonal
Antigen
Carbonic anhydrase 14 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTD
SVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQL
SLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEH
QINSEATFAELHIVHYDSDSYDSLSEAAERPQGLA
VLGIL
Storage
-20C
Provider Type Product Number
- No reagents -