Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000265-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000265-M03, RRID:AB_804901
- Product name
- AMELX monoclonal antibody (M03), clone 3B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AMELX.
- Antigen sequence
PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPY
QPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMF
PMQPLPPMLPDLTLEAWPSTDKTKREEVD- Isotype
- IgG
- Antibody clone number
- 3B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression of odontogenic ameloblast-associated protein, amelotin, ameloblastin, and amelogenin in odontogenic tumors: immunohistochemical analysis and pathogenetic considerations.
Crivelini MM, Felipini RC, Miyahara GI, de Sousa SC
Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology 2012 Mar;41(3):272-80
Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology 2012 Mar;41(3):272-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AMELX monoclonal antibody (M03), clone 3B5 Western Blot analysis of AMELX expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AMELX is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol