Antibody data

Product number
H00000265-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000265-M03A, RRID:AB_1203953
Product name
AMELX monoclonal antibody (M03A), clone 3B5
Provider product page
Abnova Corporation - H00000265-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AMELX.
Antigen sequence
PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPY
QPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMF
PMQPLPPMLPDLTLEAWPSTDKTKREEVD
Isotype
IgG
Antibody clone number
3B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -