HPA005988

AMELX antibody from Sigma-Aldrich
AIH1, AMG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005988
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005988, RRID:AB_1078145
Product name
Anti-AMELX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005988
Antibody type
Polyclonal
Antigen
Amelogenin, X isoform precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVL
SQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVP
GQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQP
MQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDL
TLEAWPSTDK
Storage
-20C
Provider Type Product Number
- No reagents -