H00010943-M

MSL3 antibody from Abnova Corporation
MSL3L1
No application information provided.

Antibody data

Product number
H00010943-M
Provider
Abnova Corporation
Product name
MSL3 mouse monoclonal antibody (hybridoma)
Provider product page
Abnova Corporation - H00010943-M
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MSL3.
Antigen sequence
MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKI
VDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAED
HVLRDTDENRRLQRKLARKAVARLRSTGRKKKRCR
LPGVDSVLKGLPTEEKDENDENSLSSSSDCSENKD
EEISEESDIEEKTEVKEEPELQTRREMEERTITIE
IPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITIL
ESYVKHFAINAAFSANERPRHHHVMPHANMNVHYI
PAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQA
QYKKVTSSKFFLPIKESATSTNRSQEELSPSPPLL
NPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRR
STRHSANCDRLSESSASPQPKRRQQDTSASMPKLF
LHLEKKTPVHSRSSSPIPLTPSKEGSAVFAGFEGR
RTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQH
LLRLFVKLPEILGKMSFSEKNLKALLKHFDLFLRF
LAEYHDDFFPESAYVAACEAHYSTKNPRAIY
Provider Type Product Number
- No reagents -