Antibody data

Product number
ABIN405271
Provider
antibodies-online
Product name
anti-Male-Specific Lethal 3 Homolog (Drosophila) (MSL3) antibody
Provider product page
antibodies-online - ABIN405271
Antibody type
Polyclonal
Antigen
The immunogen for anti-MSL3L1 antibody: synthetic peptide directed towards the N terminal of human MSL3L1
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKI
VDVIV GKDEKGRKIP
Vial size
50 µg
Provider Type Product Number
- No reagents -