SAB2101513

MSL3 antibody from Sigma-Aldrich
MSL3L1
No application information provided.

Antibody data

Product number
SAB2101513
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2101513, RRID:AB_10604704
Product name
Anti-MSL3L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2101513
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_523353.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIV
DVIVGKDEKGRKIPE
Storage
-20C
Provider Type Product Number
- No reagents -