HPA012849

STBD1 antibody from Sigma-Aldrich
FLJ41801, GENX-3414
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012849
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012849, RRID:AB_1847460
Product name
Anti-STBD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012849
Antibody type
Polyclonal
Antigen
Starch-binding domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVM
PAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGR
WNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVE
NGGVTRWEECSNRFLETGHEDKVVHAWW
Storage
-20C
Provider Type Product Number
- No reagents -