HPA011952

STBD1 antibody from Atlas Antibodies
FLJ41801, GENX-3414
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011952
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011952, RRID:AB_1847461
Product name
Anti-STBD1
Provider product page
Atlas Antibodies - HPA011952
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EHLQESNGHLISKTKDLGKLQAASWRLQNPSREVC
DNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRN
ESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNL
LKNRAKEEMSLSDLNSQDRV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -