HPA012849

antibody from Atlas Antibodies

Targeting: STBD1 FLJ41801, GENX-3414

Antibody data

Submit

Validation data

Product number: HPA012849 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA012849, RRID:AB_1847460
Product name: Anti-STBD1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: APVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVM PAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGR WNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVE NGGVTRWEECSNRFLETGHEDKVVHAWW
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

STBD1 protein structure - HPA012849 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-STBD1 antibody. Corresponding STBD1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, skeletal muscle, skin and testis using Anti-STBD1 antibody HPA012849 (A) shows similar protein distribution across tissues to independent antibody HPA011952 (B).
Antibody #2 product nr: HPA011952
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lateral ventricle shows cytoplasmic positivity in neuronal cells and glial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-STBD1 antibody HPA012849.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-STBD1 antibody HPA012849.
Sample type: HUMAN