Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00197131-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00197131-M01, RRID:AB_509160
- Product name
- UBR1 monoclonal antibody (M01), clone 2F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UBR1.
- Antigen sequence
ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFY
TAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIF
TPLEWYLFGEDPDICLEKLKHSGAFQLCG- Isotype
- IgG
- Antibody clone number
- 2F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Roles of STAT3/SOCS3 pathway in regulating the visual function and ubiquitin-proteasome-dependent degradation of rhodopsin during retinal inflammation.
Ozawa Y, Nakao K, Kurihara T, Shimazaki T, Shimmura S, Ishida S, Yoshimura A, Tsubota K, Okano H
The Journal of biological chemistry 2008 Sep 5;283(36):24561-70
The Journal of biological chemistry 2008 Sep 5;283(36):24561-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UBR1 monoclonal antibody (M01), clone 2F5 Western Blot analysis of UBR1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UBR1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol