HPA035887

COMMD8 antibody from MilliporeSigma / Merck KGaA
FLJ20502
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035887
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035887, RRID:AB_10600702
Product name
Anti-COMMD8 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035887
Antibody type
Polyclonal
Antigen
COMM domain containing 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRKDEIKQALSREIVAISSAQLQDFDWQVKLALSS
DKIAALRMPLLSLHLDVKENGEVKPYSIEMSREEL
QNLIQSLEAANKVVLQLK
Storage
-20C
Provider Type Product Number
- No reagents -