Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008546 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008546, RRID:AB_2066524
- Product name
- Anti-C2orf40
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWD
RTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDR
NGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVN
YD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references ECRG4 expression in normal rat tissues: expression study and literature review.
Cell surface localization and release of the candidate tumor suppressor Ecrg4 from polymorphonuclear cells and monocytes activate macrophages.
Porzionato A, Rucinski M, Macchi V, Sarasin G, Malendowicz LK, De Caro R
European journal of histochemistry : EJH 2015 May 18;59(2):2458
European journal of histochemistry : EJH 2015 May 18;59(2):2458
Cell surface localization and release of the candidate tumor suppressor Ecrg4 from polymorphonuclear cells and monocytes activate macrophages.
Baird A, Coimbra R, Dang X, Lopez N, Lee J, Krzyzaniak M, Winfield R, Potenza B, Eliceiri BP
Journal of leukocyte biology 2012 May;91(5):773-81
Journal of leukocyte biology 2012 May;91(5):773-81
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and C2orf40 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403168).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
- Sample type
- HUMAN