HPA035979

RGL4 antibody from Atlas Antibodies
Rgr
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA035979
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035979, RRID:AB_10673227
Product name
Anti-RGL4
Provider product page
Atlas Antibodies - HPA035979
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLLTNLPAAAVLSAQVYSAVLRGLWEENVCGTPGR
TRVCTALLYGQVCPFQDSTDGLRTITSILFNWPPE
NTSVYYQPPQRSSFRIKLAFRNLSWPGLGLEDHQE
IVLGQLVLPEPNEAKPDDPAPRPGQHAL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -