HPA008547

ZP4 antibody from Sigma-Aldrich
ZPB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008547
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008547, RRID:AB_1080766
Product name
Anti-ZP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008547
Antibody type
Polyclonal
Antigen
Zona pellucida sperm-binding protein 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FAVNLNQEATSPPVLIAWDNQGLLHELQNDSDCGT
WIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVE
GAGAAEHKVVTERKLLKCPMDLLARDAPDTDWCDS
IPA
Storage
-20C
Provider Type Product Number
- No reagents -