Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007033-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007033-M01, RRID:AB_425714
- Product name
- TFF3 monoclonal antibody (M01), clone 3D9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TFF3.
- Antigen sequence
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRG
CCFDSRIPGVPWCFKPLQEAECTF- Isotype
- IgG
- Antibody clone number
- 3D9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Circulating serum trefoil factor 3 (TFF3) is dramatically increased in chronic kidney disease.
Reproducibility of histological cell type in high-grade endometrial carcinoma.
Profiling of differentially expressed proteins in stage IV colorectal cancers with good and poor outcomes.
Fresh and cryopreserved amniotic membrane secrete the trefoil factor family peptide 3 that is well known to promote wound healing.
Genetic predisposition directs breast cancer phenotype by dictating progenitor cell fate.
Identification of serum biomarkers for colorectal cancer metastasis using a differential secretome approach.
Trefoil factor 3: a novel serum marker identified by gene expression profiling in high-grade endometrial carcinomas.
Du TY, Luo HM, Qin HC, Wang F, Wang Q, Xiang Y, Zhang Y
PloS one 2013;8(11):e80271
PloS one 2013;8(11):e80271
Reproducibility of histological cell type in high-grade endometrial carcinoma.
Han G, Sidhu D, Duggan MA, Arseneau J, Cesari M, Clement PB, Ewanowich CA, Kalloger SE, Köbel M
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2013 Dec;26(12):1594-604
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2013 Dec;26(12):1594-604
Profiling of differentially expressed proteins in stage IV colorectal cancers with good and poor outcomes.
Kim HJ, Kang UB, Lee H, Jung JH, Lee ST, Yu MH, Kim H, Lee C
Journal of proteomics 2012 Jun 6;75(10):2983-97
Journal of proteomics 2012 Jun 6;75(10):2983-97
Fresh and cryopreserved amniotic membrane secrete the trefoil factor family peptide 3 that is well known to promote wound healing.
Schulze U, Hampel U, Sel S, Goecke TW, Thäle V, Garreis F, Paulsen F
Histochemistry and cell biology 2012 Aug;138(2):243-50
Histochemistry and cell biology 2012 Aug;138(2):243-50
Genetic predisposition directs breast cancer phenotype by dictating progenitor cell fate.
Proia TA, Keller PJ, Gupta PB, Klebba I, Jones AD, Sedic M, Gilmore H, Tung N, Naber SP, Schnitt S, Lander ES, Kuperwasser C
Cell stem cell 2011 Feb 4;8(2):149-63
Cell stem cell 2011 Feb 4;8(2):149-63
Identification of serum biomarkers for colorectal cancer metastasis using a differential secretome approach.
Xue H, Lü B, Zhang J, Wu M, Huang Q, Wu Q, Sheng H, Wu D, Hu J, Lai M
Journal of proteome research 2010 Jan;9(1):545-55
Journal of proteome research 2010 Jan;9(1):545-55
Trefoil factor 3: a novel serum marker identified by gene expression profiling in high-grade endometrial carcinomas.
Bignotti E, Ravaggi A, Tassi RA, Calza S, Rossi E, Falchetti M, Romani C, Bandiera E, Odicino FE, Pecorelli S, Santin AD
British journal of cancer 2008 Sep 2;99(5):768-73
British journal of cancer 2008 Sep 2;99(5):768-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TFF3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to TFF3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol