Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007033-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007033-M02, RRID:AB_464030
- Product name
- TFF3 monoclonal antibody (M02), clone 3G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TFF3.
- Antigen sequence
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRG
CCFDSRIPGVPWCFKPLQEAECTF- Isotype
- IgG
- Antibody clone number
- 3G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification and use of the putative Bacteroides ovatus xylanase promoter for the inducible production of recombinant human proteins.
Hamady ZZ, Farrar MD, Whitehead TR, Holland KT, Lodge JP, Carding SR
Microbiology (Reading, England) 2008 Oct;154(Pt 10):3165-74
Microbiology (Reading, England) 2008 Oct;154(Pt 10):3165-74
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TFF3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol