Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA027850 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA027850, RRID:AB_10600868
- Product name
- Anti-DMRT1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQT
GNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSV
PQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSS
SSPISNKSTKAVLECEPASEPSSFTVTPVI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The human testis-specific proteome defined by transcriptomics and antibody-based profiling
Fibroblast growth factor receptor 3 is highly expressed in rarely dividing human type A spermatogonia
Differential marker protein expression specifies rarefaction zone-containing human Adark spermatogonia
Djureinovic D, Fagerberg L, Hallstrom B, Danielsson A, Lindskog C, Uhlen M, Ponten F
Molecular Human Reproduction 2014 May;20(6):476-488
Molecular Human Reproduction 2014 May;20(6):476-488
Fibroblast growth factor receptor 3 is highly expressed in rarely dividing human type A spermatogonia
Kopylow K, Staege H, Schulze W, Will H, Kirchhoff C
Histochemistry and Cell Biology 2012 November;138(5):759-772
Histochemistry and Cell Biology 2012 November;138(5):759-772
Differential marker protein expression specifies rarefaction zone-containing human Adark spermatogonia
von Kopylow K, Staege H, Spiess A, Schulze W, Will H, Primig M, Kirchhoff C
Reproduction 2012 January;143(1):45-57
Reproduction 2012 January;143(1):45-57
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and DMRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411862).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and fallopian tube tissues using HPA027850 antibody. Corresponding DMRT1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows no nuclear positivity in glandular cells as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows no positivity in glandular cells as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows no nuclear positivity in glandular cells as expected.
- Sample type
- HUMAN
