HPA016903

CD46 antibody from Sigma-Aldrich
MCP, MGC26544, MIC10, TLX, TRA2.10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016903
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016903, RRID:AB_1846309
Product name
Anti-CD46 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016903
Antibody type
Polyclonal
Antigen
Membrane cofactor protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIG
ESTIYCGDNSVWSRAAPECKVVKCRFPVVENGKQI
SGFGKKFYYKATVMFECDKGFYLDGSDTIVCDSNS
TWDPPVPKCLK
Storage
-20C
Provider Type Product Number
- No reagents -