HPA016903

CD46 antibody from Atlas Antibodies
MCP, MGC26544, MIC10, TLX, TRA2.10
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016903
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016903, RRID:AB_1233771
Product name
Anti-CD46
Provider product page
Atlas Antibodies - HPA016903
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIG
ESTIYCGDNSVWSRAAPECKVVKCRFPVVENGKQI
SGFGKKFYYKATVMFECDKGFYLDGSDTIVCDSNS
TWDPPVPKCLK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -