HPA007619

MPL antibody from Sigma-Aldrich
CD110, TPOR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007619
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007619, RRID:AB_1854080
Product name
Anti-MPL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007619
Antibody type
Polyclonal
Antigen
Thrombopoietin receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRLRHALWPSLPDLHRVLGQYLRDTAALSPPKATV
SDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDY
RRLQPSCLGTMPLSVCPPMAESGSCCTTHIANHSY
LPLSYWQQ
Storage
-20C
Provider Type Product Number
- No reagents -