HPA076168

CNGA1 antibody from Atlas Antibodies
CNCG, CNCG1, CNG1, RCNC1, RCNCa, RP49

Antibody data

Product number
HPA076168
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA076168, RRID:AB_2686781
Product name
Anti-CNGA1
Provider product page
Atlas Antibodies - HPA076168
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASTSEESENENPHARGSFSYKSLRKGGPSQREQYL
PGAIALFNVNNSSNKDQEPEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -