H00001259-B01P

CNGA1 antibody from Abnova Corporation
CNCG, CNCG1, CNG1, RCNC1, RCNCa, RP49
No application information provided.

Antibody data

Product number
H00001259-B01P
Provider
Abnova Corporation
Product name
CNGA1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00001259-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CNGA1 protein.
Antigen sequence
MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRME
NGACSSFSEDDDSASTSEESENENPHARGSFSYKS
LRKGGPSQREQYLPGAIALFNVNNSSNKDQEPEEK
KKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKK
EEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLP
VMYNWTMVIARACFDELQSDYLEYWLILDYVSDIV
YLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQ
FKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSR
MFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNA
CVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYV
YSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIG
VLIFATIVGNIGSMISNMNAARAEFQARIDAIKQY
MHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLK
YLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVE
LVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLA
VVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNR
RTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTML
EEKGKQILMKDGLLDLNIANAGSDPKDLEEKVTRM
EGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKF
LKPLIDTEFSSIEGPGAESGPIDST
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -