Antibody data

Product number
H00091734-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00091734-M01, RRID:AB_1576157
Product name
IDI2 monoclonal antibody (M01), clone 1C11
Provider product page
Abnova Corporation - H00091734-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant IDI2.
Antigen sequence
MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADT
KRNCHLNENIEKGLLHRAFSVVLFNTKNRILIQQR
SDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVR
RAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKS
DRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLS
QEELWELLEREARGEVKVTPWLRTIAERFLYRWWP
HLDDVTPFVELHKIHRV
Isotype
IgG
Antibody clone number
1C11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -