HPA001218

DRG1 antibody from Sigma-Aldrich
NEDD3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001218
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001218, RRID:AB_1078704
Product name
Anti-DRG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001218
Antibody type
Polyclonal
Antigen
Developmentally-regulated GTP-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQS
ELDAETVKSILAEYKIHNADVTLRSDATADDLIDV
VEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCV
PISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLP
DYT
Storage
-20C
Provider Type Product Number
- No reagents -