AV34132

RCOR3 antibody from Sigma-Aldrich
FLJ10876
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV34132
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV34132, RRID:AB_1856159
Product name
Anti-RCOR3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV34132
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human RCOR3 with an internal ID of P05602
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
RVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYH
SIPDAKLDEYIAIAK
Storage
-20C
Provider Type Product Number
- No reagents -