HPA007413

RCOR3 antibody from Sigma-Aldrich
FLJ10876
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007413
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007413, RRID:AB_1079796
Product name
Anti-RCOR3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007413
Antibody type
Polyclonal
Antigen
REST corepressor 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSRTSLMDRQARKLANRHNQGDSDDDVEETHPMDG
NDSDYDPKKEAKKEGNTEQPVQTSKIGLGRREYQS
LQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAA
NT
Storage
-20C
Provider Type Product Number
- No reagents -