Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003422-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003422-M01, RRID:AB_509261
- Product name
- IDI1 monoclonal antibody (M01), clone 6G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IDI1.
- Antigen sequence
IPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYI
LLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAA
SGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHE
KIYR- Isotype
- IgG
- Antibody clone number
- 6G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IDI1 monoclonal antibody (M01), clone 6G10 Western Blot analysis of IDI1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of IDI1 expression in transfected 293T cell line by IDI1 monoclonal antibody (M01), clone 6G10.Lane 1: IDI1 transfected lysate(26.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IDI1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol