HPA031862

NLN antibody from MilliporeSigma / Merck KGaA
AGTBP, KIAA1226
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031862
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031862, RRID:AB_10600827
Product name
Anti-NLN antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031862
Antibody type
Polyclonal
Antigen
neurolysin (metallopeptidase M3 family) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQ
IKTRTEELIVQTKQVYDAVGMLGIEEVTYENCL
Storage
-20C
Provider Type Product Number
- No reagents -